PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000554.1.g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 156aa    MW: 16994.6 Da    PI: 8.3633
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000554.1.g00007.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.21.2e-428106199
                          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgv 79 
                                     +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvh+++Gasnv k+l++l+  +reda++sl+yeAear+rdPvyG+vg+
  FANhyb_rscf00000554.1.g00007.1   8 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHRVYGASNVAKILNELNAAHREDAVTSLAYEAEARLRDPVYGCVGL 86 
                                     7****************************************************************************** PP

                          DUF260  80 ilklqqqleqlkaelallke 99 
                                     i+ lq +l++l+++l  +k+
  FANhyb_rscf00000554.1.g00007.1  87 ISILQDRLKKLQTDLYNAKK 106
                                     **************988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.7657108IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-428105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MSSNTHSPCA ACKFLRRKCT QECVFAPYFP PDQPQKFANV HRVYGASNVA KILNELNAAH  60
REDAVTSLAY EAEARLRDPV YGCVGLISIL QDRLKKLQTD LYNAKKDLST YIGPQALMIP  120
VFHPSPQPEM NGGGAMAVPM LGVPTGPQQV PSGYGC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011460241.11e-107PREDICTED: LOB domain-containing protein 36-like
RefseqXP_011460240.11e-107PREDICTED: LOB domain-containing protein 36-like
RefseqXP_011460239.11e-107PREDICTED: LOB domain-containing protein 36-like
RefseqXP_011460238.11e-107PREDICTED: LOB domain-containing protein 36-like
RefseqXP_011460237.11e-107PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ39e-68LBD36_ARATH; LOB domain-containing protein 36
TrEMBLM5WIQ11e-89M5WIQ1_PRUPE; Uncharacterized protein
STRINGVIT_00s1247g00010.t018e-72(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.16e-69ASYMMETRIC LEAVES 2-like 1